SKRIPSI Jurusan Biologi - Fakultas MIPA UM, 2019

Ukuran Huruf:  Kecil  Sedang  Besar

Identifikasi Variasi Genetik Sekuens Gen Sex-determining Region Y (SRY) pada Sapi Pejantan Lokal Madura

Amin Achmad Makin

Abstrak


RINGKASAN

Amin, Achmad Makin. 2019. Identifikasi Variasi Genetik Sekuens Gen Sexdetermining Region Y (SRY) pada Sapi Pejantan Lokal Madura.Skripsi. Jurusan Biologi, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. agr. Mohamad Amin, S.Pd, M.Si (II) Dr. Umie Lestari, M.Si

Kata kunci:Variasi, Genetik, Gen SRY, Sapi Madura.

Kekayaan fauna Indonesia yang muncul karena isolasi geografis diantaranya yaitu sapi Madura. Peristiwa isolasi dapat meningkatkan inbreeding yang berdampak pada penurunan kemampuan bertahan hidup dan reproduksi. Sehingga, akan kurang adaptif terhadap keadaan lingkungan yang fluktutif. Padahal sapi Madura memiliki keunggulan dapat beradaptasi pada suhu panas, tahan penyakit caplak dan cekaman iklim ekstrim. Adanya variasi genetik mampu meningkatkan sifat adaptif terhadap lingkungan sehingga tetap mampu berkembang biak dan fertil. Maka perlu adanya kajian mengenai identifikasi variasi genetik pada gen pengatur reproduksi pejantan superior yang diakibatkan oleh seleksi dari faktor lingkungan yang sangat berperan penting dalam fertilitas reproduksi. Salah satu gen pengatur pembentukan kelamin pada jantan yaitu gen Sex-determining RegionY (SRY) yang dominan mengatur regulasi determinasi seks dan penanda fertil pada sapi pejantan. Penelitian ini bertujuan untuk mengetahui variasi genetik sekuens DNA gen SRY pada sapi pejantan lokal Madura. Jenis data dalam penelitian ini yaitu deskriptif kualitatif. Metode penelitian yang digunakan untuk isolasi DNA darah total yaitu metode fenol kloroform. Gen SRY diamplifikasi dengan primer forward SRY-4: 5’–GCC TGG ACT TTC TTG TGC TTA–3’ dan reverse SRY-5: 5’–ACA GTG GGA ACA AAA GAC TAT–3’ dari hasil isolasi DNA darah total dengan metode PCR. Hasil amplifikasi divisualisasi dengan elektroforesis gel agarose 2%. Sampel amplifikasi gen SRY diproses sekuensing DNA dan dianalisis secara bioinformatika dengan menggunakan software BioEdit, MEGA6, program BLAST webserver NCBI, ExPASy dan Swiss-Model. Hasil elektroforegram PCR gen SRY menunjukkan band dengan panjang + 600pb. Hasil sekuensing DNA gen SRY menunjukkan kedua sampel memiliki homologi sebesar 99,67 % dengan sekuens gen SRY Bos taurus pada GeneBank (Accesion Number DQ336526.2). Pada sampel 1 Kanang (M_6) dan 2 Kanwa (M_8) menunjukkan bahwa terjadi mutasi transversi pada urutan basa ke 4 dengan pola monomorphicdan prediksi polipeptida dengan webserver Swiss-Model menunjukkan hasil polipeptida yang sama dari kedua sampel tersebut, yaitu AP-1 Complex dengan urutan asam amino sebagai berikut LQTIVLSEILTNSW YRVKNLVLGWKAPYILKHFLVQGLFFGLSSYFPPLCKLQVISEYICIFYLLS QFIVFCPP. AP-1 Complex memiliki peran penting sebagai faktor transkripsi dalam perkembangan normal testis.

SUMMARY

Amin, Achmad Makin. 2019. Identification of Genetic Variations in the Sexdetermining Region Y (SRY) Gene Sequence in Local Madura Cattle. Thesis. Department of Biology, Faculty of Mathematic and Natural Sciences, State University of Malang. Advisor: (I) Prof. Dr. agr. Mohamad Amin, S.Pd, M.Si (II) Dr. Umie Lestari, M.Si

Keywords: Variations, Genetic, SRY Gene, Madura Cattle.

The wealth of Indonesian fauna that arises due to geographical isolation called Madura cattle. Isolation events can increase increased resistance to sustainable survival. Tend to, will be less adaptive to fluctuating environmental conditions. Even though Madura cattle have the advantage of being able to overcome hot temperatures, resistant to tick disease and extreme climate stress. The presence of genetic variation can improve adaptive properties to the environment and culture and fertilizers. Hence there is a need for a study of identification of genetic variation in superior male reproductive regulating genes caused by selection of environmental factors that play an important role in reproductive fertility. One of the genes that determine sex in males is the dominant Sex-determination Region Y (SRY) gene that regulates the registration of sex determinations and fertilizer markers in male cattle. This study studied the genetic variation of SRY gene DNA in local male Madura cattle. The type of data in this study is qualitative descriptive. The research method used for total blood DNA isolation was the phenol-chloroform method. The SRY gene was amplified with forward primer: SRY-4: 5’–GCC TGG ACT TTC TTG TGC TTA–3’ and reverse SRY-5: 5’–ACA GTG GGA ACA AAA GAC TAT–3’ from total DNA testing using the PCR method. The amplification results were visualized by agarose gel electrophoresis 2%. The SRY gene amplification samples were processed by DNA sequencing and analyzed bioinformatics using software BioEdit, MEGA6, NCBI, ExPASy and programs BLAST, web server Swiss-Model. The results of the SRY PCR gene electrogram show bands with a length of + 600pb. The results of the SRY gene sequencing showed that both of the second sample had a homology of 99.67% with the SRY gene Bos taurus sequence in the GeneBank (Accession Number DQ336526.2). In samples 1 Kanang (M_6) and 2 Kanwa (M_8) showed that there was a transversion mutation in the 4th base with a monomorphic pattern and the prediction of polypeptides with the Swiss-Model web server showed the same polypeptide results from the two samples, namely AP-1 Complex with amino acids as follows LQTIVLSEILTNSWYRVKNLVLG WKAPYILKHFLVQGLFFGLSSYFPPLCKLQVISEYICIFYLLSQFIVFCPP. The AP-1 complex has an important role as a transcription factor in the development of normal testes.